As part of your purchase today you will be enrolled in our auto-delivery programwhich allows you to cancelreschedule or customize future shipments at any time with no minimum purchase required. Price and offer details for your selection to be presented at checkout. All purchases are covered by our
60-Day Money-Back Guarantee
If for any reasonyou’re not completely satisfiedjust return the containers within 60 days of receipt for a full refund of the purchase price (less S&H)—even if the containers are empty. Any free gifts you receive are yours to keep!
SELECT YOUR SYSTEM
An advancednon-foaming formula designed to protect your moisture barrier without fragrance or sulfates. This gentlecreamy cleanser washes away makeup and impurities without drying or strippingleaving skin softsmooth and glowing. Now formulated with our exclusive Melon Leaf Stem Cell Technology and galactaric acid — a powerful antioxidant designed to help minimize the signs of aging. Suitable for all skin types. Apply cleanser onto dry face and neck. Massage using gentle circular motions. Rinse with warm water and dry with a clean cotton pad. Use morning and evening. Leaves skin feeling refreshedsoft and hydrated Balances natural pH Helps dissolve excess oilimpurities and makeup
WaterPropylene GlycolCetyl AlcoholStearyl AlcoholSodium Laureth SulfateSodium Laureth-8 SulfateMagnesium Laureth SulfateMagnesium Laureth-8 SulfateSodium Oleth SulfateMagnesium Oleth SulfateGalactaric AcidEthylhexylglycerinSodium HydroxideCaprylyl GlycolHexylene GlycolPhenoxyethanol Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.
The nighttime is the ideal time to restore skin as our own mechanisms are in repair mode. This night cream combines our exclusive melon super antioxidants with powerful retinol so that fine lineswrinklesfirmnesselasticity and skin’s texture are rejuvenated. The gentle formulation prevents the irritation sometimes associated with retinol.
In the eveningapply a thin layer onto face. Massage evenly and gently into skin.
Reduce frequency if sensitivity occurs. Recommended to use an SPF moisturizer during the day if using a retinol product at night.
- Intensely hydrating overnight treatment
- Improves the look of fine lineswrinklesfirmnesselasticity and skin texture
- Renews skin’s appearance without risk of irritation from retinol
- Improves visible length and depth of fine lines and wrinkles
Water (Aqua)Isononyl IsononanoateEthylhexyl PalmitatePolyglyceryl-10 DistearatePrunus Amygdalus Dulcis (Sweet Almond) OilPolysorbate 20Dicaprylyl MaleatePolymethyl MethacrylatePolyacrylate-13Castor Isostearate SuccinateMaltooligosyl GlucosideVegetable Oil (Olus Oil)Isopropyl MyristateRetinolCucumis Melo (Melon) Fruit ExtractTocopherolAscorbyl Methylsilanol PectinateHydrogenated Vegetable OilHippophae Rhamnoides OilElaeis Guineensis (Palm) OilOrchid Leaf/Root/Stem ExtractOlivine ExtractSoluble CollagenC14-22 AlcoholsJojoba AlcoholPotassium JojobatePolyisobuteneButylene GlycolHydrogenated Starch HydrolysateMagnesium Aluminum SilicatePalmitoyl ProlinePalmitic AcidEthylene BrassylateC12-20 Alkyl GlucosideHexapeptide-9Hexylene GlycolEthylhexylglycerinSodium Palmitoyl SarcosinateMagnesium Palmitoyl GlutamateDecarboxy Carnosine HClDisodium EDTAUndecaneTridecaneTocotrienolsBenzoic AcidPhenoxyethanolCaprylyl GlycolFragrance (Parfum)*CitronellolOrange 4 (CI 15510)Red 40 (CI 16035)
Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.
An advancednon-foaming formula designed to protect your moisture barrier without fragrance or sulfates. This gentlecreamy cleanser washes away makeup and impurities without drying or strippingleaving skin softsmooth and glowing. Now formulated with our exclusive Melon Leaf Stem Cell Technology and galactaric acid — a powerful antioxidant designed to help minimize the signs of aging. Suitable for all skin types. Apply cleanser onto dry face and neck. Massage using gentle circular motions. Rinse with warm water and dry with a clean cotton pad. Use morning and evening. Leaves skin feeling refreshedsoft and hydrated Balances natural pH Helps dissolve excess oilimpurities and makeup
WaterPropylene GlycolCetyl AlcoholStearyl AlcoholSodium Laureth SulfateSodium Laureth-8 SulfateMagnesium Laureth SulfateMagnesium Laureth-8 SulfateSodium Oleth SulfateMagnesium Oleth SulfateGalactaric AcidEthylhexylglycerinSodium HydroxideCaprylyl GlycolHexylene GlycolPhenoxyethanol Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.
The nighttime is the ideal time to restore skin as our own mechanisms are in repair mode. This night cream combines our exclusive melon super antioxidants with powerful retinol so that fine lineswrinklesfirmnesselasticity and skin’s texture are rejuvenated. The gentle formulation prevents the irritation sometimes associated with retinol.
In the eveningapply a thin layer onto face. Massage evenly and gently into skin.
Reduce frequency if sensitivity occurs. Recommended to use an SPF moisturizer during the day if using a retinol product at night.
- Intensely hydrating overnight treatment
- Improves the look of fine lineswrinklesfirmnesselasticity and skin texture
- Renews skin’s appearance without risk of irritation from retinol
- Improves visible length and depth of fine lines and wrinkles
Water (Aqua)Isononyl IsononanoateEthylhexyl PalmitatePolyglyceryl-10 DistearatePrunus Amygdalus Dulcis (Sweet Almond) OilPolysorbate 20Dicaprylyl MaleatePolymethyl MethacrylatePolyacrylate-13Castor Isostearate SuccinateMaltooligosyl GlucosideVegetable Oil (Olus Oil)Isopropyl MyristateRetinolCucumis Melo (Melon) Fruit ExtractTocopherolAscorbyl Methylsilanol PectinateHydrogenated Vegetable OilHippophae Rhamnoides OilElaeis Guineensis (Palm) OilOrchid Leaf/Root/Stem ExtractOlivine ExtractSoluble CollagenC14-22 AlcoholsJojoba AlcoholPotassium JojobatePolyisobuteneButylene GlycolHydrogenated Starch HydrolysateMagnesium Aluminum SilicatePalmitoyl ProlinePalmitic AcidEthylene BrassylateC12-20 Alkyl GlucosideHexapeptide-9Hexylene GlycolEthylhexylglycerinSodium Palmitoyl SarcosinateMagnesium Palmitoyl GlutamateDecarboxy Carnosine HClDisodium EDTAUndecaneTridecaneTocotrienolsBenzoic AcidPhenoxyethanolCaprylyl GlycolFragrance (Parfum)*CitronellolOrange 4 (CI 15510)Red 40 (CI 16035)
Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.
SELECT YOUR FREE GIFTS
- Provides deepintense hydration
- Helps brighten and even skin tone
- Calms and soothes stressed skin
- HEAT
Helps soothe skin and promote the absorption of serums and crèmes - MASSAGE
Helps reduce the appearance of puffiness - RED LIGHT
Helps promote the appearance of radianthealthy-looking skin - Targets fine lines and wrinkles
- Helps skin look and feel more radiant
- Helps skin look and feel firmerplumpersmoother
Our next-levelexclusive Melon Leaf Stem Cell Technology is the hero ingredient in this cooling gel serum for the eyes. A morning refresherYouth Activating Smoothing and Refreshing Eye Serum is a new way to deliver this powerful complex to the delicate under-eye areawhich often needs attention the most. There’s both an instantvisible effect of hydrating and smoothing fine lines and wrinkles as well as firming the look of this area over time.
With gentle pressuremassage metal tip on the under-eye area. Use finger to smooth any excess until absorbed. Store in fridge for an extra cooling effect. Use daily in the morning.
WaterGlycerinIsononyl IsononanoateButylene GlycolPropanediolPentylene GlycolTocopherolLimnanthes Alba Seed OilAvena Sativa (Oat) Kernel ExtractCucumis Melo Cantalupensis Callus ExtractRicinus Communis (Castor) Seed OilCaprylic/Capric TriglycerideDisodium EDTAEthylhexylglycerinAmodimethiconeCastor Oil/IPDI CopolymerCarbomerSodium HydroxidePhenoxyethanolBlue 1 Lake (CI 42090).
Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.
This potent multi-tasking facial mist is both an intense hydrator and a calming skin de-stresser. Hyaluronic acida unique hibiscus extract and a moisture-retaining sugar derivative combine to provide deepsoothing hydration. A powerful ingredient derived from Lactobacillus probiotic and niacinamide helps to brighten skin and improve elasticity. Damask rose oil and rose extract help protect skin from external aggressors and help provide a smoothermore luminous complexion.
Use in the morning to nourish and reset skinas a mid-day hydration boostor whenever you need a refreshing pick-me-up at homeworkor on the go.
Shake gently before use. Spritz face two to three times from six inches away. Can be used before serum to soothe and hydrate or throughout the day for a boost of hydration. Will not interfere with makeup.
WaterLactobacillus FermentGlycerinPentylene GlycolPropanediolNiacinamideRosa Damascena Flower OilHibiscus Sabdariffa Fruit ExtractRosa Damascena Flower WaterSaccharide Isomerate1,2-HexandiolErythritolHyaluronic AcidEthylhexylglycerinTrisodium Ethylenediamine DisuccinatePhenoxyethanol.
Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.
This handheld Skin Renewing Facial Tool combines 9 levels of heat with facial massage and red light to sootheenergize and enhance skin. The wand helps to promote the appearance of radianthealthy-looking skingives instant relaxation and massages facial musclesall while providing the benefits of red light. The result? Reduced appearance of puffinessboosted absorption of our serums and crèmes and a revitalized appearance of skin.
WHAT'S INCLUDED: Skin Renewing Facial ToolUSB Charging CableMicrofiber ClothUser Manual
For optimal resultsuse with one of Meaningful Beauty’s treatmentsserums or crèmes. Start by applying the cream as directed with your fingertips. Using small circular motionsglide the device slowly and gently over expression lines around the foreheadmouth and eyes.
DURATION OF USE: 1-3 minutes per targeted area up to 15 minutes of use.
RECOMMENDED FREQUENCY: 3-5 times per week.
Are you seeing fine lines and wrinkles around the mouth (“marionette lines”)eyes (“crow’s feet) or forehead (“11 lines”)? These single-dose capsules are packed with our melon super antioxidants and a peptide blend to spot target lines and wrinkles in a concentrated application. Can also be used all over the face.
These convenient single-dose capsules help skin look smootherfirmer and plumper right where it needs it most. Designed to work instantly after the first application.
Gently open capsule by twisting off the small nodule end. Apply topically to specific areas of concern or all over the face. Can be used alone or under makeup.
CyclopentasiloxaneDimethicone CrosspolymerZinc OxideCucumis Melo (Melon) Fruit ExtractMyristoyl Pentapeptide-8Myristoyl Tetrapeptide-8Oryza Sativa (Rice) ExtractHelianthus Annuus (Sunflower) Seed OilLupinus Albus Seed ExtractOlea Europaea (Olive) Fruit OilSimmondsia Chinensis (Jojoba) Seed ExtractTocopherolGlycerinMaltodextrinDimethiconolMethyl Methacrylate/Glycol Dimethacrylate CrosspolymerHydroxypropyltrimonium Maltodextrin Crosspolymer.
Warnings: For external use only. Avoid contact with eyes. If eye contact occursflush gently and thoroughly with water. Discontinue use and consult a physician if irritation develops.